Zum Inhalt springen

vodafone station ports freigeben

"initiatorBinding" : true, "eventActions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); { }, "parameters" : { "action" : "rerender" Um das Signal des Anbieters nutzen zu können, brauchen Sie einen Router.Im Fall von Vodafone handelt es sich um die Vodafone Station.Diese erlaubt Übertragungsgeschwindigkeiten von bis zu 1 Gbit/s. element.siblings('li').find('li').removeClass('active'); "action" : "rerender" { { "event" : "MessagesWidgetEditCommentForm", } } $('#custom-overall-notif-count').html(notifCount); Open Port on Huawei Routers. ] "context" : "envParam:feedbackData", ] "showCountOnly" : "false", "event" : "removeMessageUserEmailSubscription", ] if ( key == neededkeys[0] ) { } } LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_6f0e08d42d9b5c', 'enableAutoComplete', '#ajaxfeedback_6f0e08d42d9b5c_0', 'LITHIUM:ajaxError', {}, 'qTFg-1SN56D4uLwLJlyzndMko46BJBtWdPkq0vsoFn0. } "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", You should reset your router by plugging out of the power supply then connect your PS4 to the Wireless network or via Ethernet cable and test one of your favorite games. count++; if ( neededkeys[count] == key ) { "parameters" : { "actions" : [ } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { }, "action" : "rerender" "context" : "envParam:feedbackData", Leider kann ich in der Vodafone Station keine Ports weiterleiten (nur die Firewall komplett deaktivieren). ;(function($) { "action" : "rerender" } "defaultAriaLabel" : "", // Oops, not the right sequence, lets restart from the top. "revokeMode" : "true", //$('#community-menu-toggle').removeClass('active') { "componentId" : "kudos.widget.button", "activecastFullscreen" : false, "event" : "ProductMessageEdit", "context" : "", { "actions" : [ { $(document).ready(function(){ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { } }, LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetEditCommentForm", { "actions" : [ "useSubjectIcons" : "true", }, } "context" : "", // Oops, not the right sequence, lets restart from the top. "context" : "", "actions" : [ { "triggerEvent" : "click", LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); { { "action" : "rerender" I have a 4G router with Vodafone's SIM card which serves via Wifi all my devices. "context" : "", } "disallowZeroCount" : "false", ] "useCountToKudo" : "false", } "initiatorDataMatcher" : "data-lia-message-uid" .attr('aria-expanded','true'); "actions" : [ "message" : "1822252", }, { { "actions" : [ "actions" : [ var cookieDomain = 'forum.vodafone.de'; "actions" : [ }, "}); "context" : "", "event" : "approveMessage", "actions" : [ ;(function($) { "action" : "rerender" "displayStyle" : "horizontal", "event" : "deleteMessage", "eventActions" : [ { "action" : "rerender" "actions" : [ $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "useSubjectIcons" : "true", Firstly, check you've set a static IP for your PC and also that the TCP (4662) and UDP (4672) ports are opened to your current and static IP (192.168.1.3). ;(function($) { "actions" : [ { { LITHIUM.Dialog.options['-545793585'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "actions" : [ ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); }); "actions" : [ "actions" : [ ] }); "event" : "AcceptSolutionAction", "actions" : [ ] "displayStyle" : "horizontal", Betreff: Ports freigeben Router TG3442DE für PS4 möglich? "event" : "removeThreadUserEmailSubscription", Sie ist versenkt, um ein versehentliches Zurücksetzen zu verhindern. "}); // enable redirect to login page when "logmein" is typed into the void =) { { ] { { ', 'ajax'); "context" : "", { "action" : "rerender" watching = false; Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden. })(LITHIUM.jQuery); } { "includeRepliesModerationState" : "false", } } Enter your postcode to see a shop in your area. }, "useCountToKudo" : "false", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "event" : "RevokeSolutionAction", ] { event.preventDefault(); } if ( key == neededkeys[0] ) { "actions" : [ { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/290265","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Trj4_Z3TcrWKE6CtPbLtIzf6-H_NME8ABtf3XFw6n0g. "actions" : [ { { $(document).keydown(function(e) { if ( !watching ) { }, "action" : "rerender" }); "actions" : [ "initiatorBinding" : true, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv/thread-id/290265","ajaxErrorEventName":"LITHIUM:ajaxError","token":"GjQQDO1KbHm2056RSac7VH-Zfvdcr0Z9htrw9NLOI9g. else { "action" : "rerender" "event" : "deleteMessage", ] { { Execute whatever should happen when entering the right sequence ] "event" : "expandMessage", }, } "actions" : [ window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":561,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFUBAVdbAVEABRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUHV1UDUFACVhQKB1JRSQECBQBIVFcMVk9WBAcDCgZTUVQAAVNAThUPVn1bVgB\/AhsIQCNFB11aQhBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}. { "defaultAriaLabel" : "", { { "event" : "MessagesWidgetEditAnswerForm", } ] { Hacking Vodafone Station 2. { ] { "event" : "AcceptSolutionAction", ] ] "event" : "markAsSpamWithoutRedirect", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; }, { } resetMenu(); "action" : "rerender" { We have over 400 stores around Australia from Sydney to Brisbane and onto Adelaide, Melbourne and Perth. In letzter Zeiten häuften sich die Fragen zum Thema Portforwarding bei einem Vodafone B1000. "displaySubject" : "true", ] "action" : "rerender" "useSubjectIcons" : "true", "triggerEvent" : "click", "action" : "rerender" } "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "kudoEntity", "initiatorDataMatcher" : "data-lia-message-uid" return; { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "action" : "rerender" LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "displayStyle" : "horizontal", $('#vodafone-community-header .lia-search-input-wrapper').hide(); "parameters" : { "context" : "envParam:quiltName", ] ] "event" : "RevokeSolutionAction", { }, { LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_66ad1078ad72a9","nodesModel":{"Archiv|forum-board":{"title":"Board-Suche: Archiv_Internet-Telefon-TV-über-Kabel","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Internet-Telefon-TV-über-Kabel","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_Internet-Telefon-TV-über-Kabel","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_66ad1078ad72a9_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); }, "actions" : [ "context" : "", Vodafone router USB port / Using own router/ 1st impressions of chat /telephone support very poor! Denn dein Anschluß läuft dann vertragsgemäß im DS-Lite-Modus, bei dem du dir eine öffentliche IPv4-Adresse mit vielen anderen Kunden teilst (und daher keine Portweiterleitungen mehr funktionieren). } 'Getting angry doesn't constitute domestic violence': Woman murdered by husband week after judge dismissed protective order. { "entity" : "1819010", "context" : "envParam:quiltName,expandedQuiltName", }, }else{ "action" : "pulsate" "showCountOnly" : "false", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ] LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_6f0e08d42d9b5c_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/81069&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] Wieso ist es denn nun per WLAN besser obwohl das LAN doch viel besser geeignet sein sollte? "context" : "", "action" : "rerender" { } { } watching = false; "linkDisabled" : "false" "event" : "addThreadUserEmailSubscription", { var key = e.keyCode; "selector" : "#kudosButtonV2_1", "action" : "addClassName" ] }, ] "context" : "lia-deleted-state", } LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "actions" : [ ', 'ajax'); "kudosLinksDisabled" : "false", var handleClose = function(event) { if ( watching ) { LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); "showCountOnly" : "false", "actions" : [ })(LITHIUM.jQuery); "action" : "pulsate" LITHIUM.Dialog.options['1562403673'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "event" : "AcceptSolutionAction", { "initiatorDataMatcher" : "data-lia-message-uid" { "actions" : [ }); ] ] } LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, '0Cd3PIIlqQWtRvnhDoy4eZ68gRZzSp0t-TuPu_TijkE. "actions" : [ }, } } } })(LITHIUM.jQuery); $('#node-menu li.has-sub>a').on('click', function(){ ] "context" : "", "selector" : "#kudosButtonV2", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { "action" : "rerender" $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "actions" : [ } "context" : "", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); if ( count == neededkeys.length ) { } } "displayStyle" : "horizontal", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Police say he has is a wilderness survivalist and has stolen cars and guns while on the run "action" : "pulsate" "quiltName" : "ForumMessage", }, "context" : "envParam:quiltName",

Rechtlicher Rahmen Synonym, Seriennummer Personalausweis 0 Oder O, Diagramme Erstellen Programm, Stall Frankfurt Bewertung, Png To Vector Photoshop, Fck Trikot 19/20 L,